PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.T3G5J
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Dof
Protein Properties Length: 183aa    MW: 20960.2 Da    PI: 8.5807
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.T3G5JgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.7e-391371361
       zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                 e  +kcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk++
  Araip.T3G5J 13 EGGVKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGSRKNKRR 71
                 56789***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-261070IPR003851Zinc finger, Dof-type
PfamPF027018.3E-341670IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1431670IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101854IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MALRQWAVEE KEEGGVKCPR CDSSNTKFCY YNNYSLSQPR HFCKACKRYW TRGGTLRNVP  60
VGGGSRKNKR RLNHPHPNTT SSQINNNNDD VNLPSLFHTF TSDAALQNNH VFAASSSSYD  120
SILLPPTMMP MQQNLINGGY YCQNQIEQQH HVPNFSDPNS LYYWSNAFTS WNNDNNHHLT  180
SLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016181128.11e-129PREDICTED: dof zinc finger protein DOF2.2
TrEMBLA0A0D2R8G25e-34A0A0D2R8G2_G
STRINGGSMUA_Achr9P25010_0012e-33(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.13e-34Dof family protein